| Product Number |
ARP33162_P050 |
| Product Page |
www.avivasysbio.com/znf395-antibody-c-terminal-region-arp33162-p050.html |
| Name |
ZNF395 Antibody - C-terminal region (ARP33162_P050) |
| Protein Size (# AA) |
513 amino acids |
| Molecular Weight |
55kDa |
| NCBI Gene Id |
55893 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 395 |
| Alias Symbols |
PBF, PRF1, HDBP2, PRF-1, HDBP-2, HDRF-2, Si-1-8-14 |
| Peptide Sequence |
Synthetic peptide located within the following region: GLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tanaka,K., et al., (2004) J. Biol. Chem. 279 (8), 7275-7286 |
| Description of Target |
ZNF395 is a novel transcription factor shuttling between nucleus and cytoplasm and bind to the specific GCCGGCG, which is an essential cis-element for HD gene expression in neuronal cells. ZNF395 might play a role in transcription of PV genes and in E2-mediated repression. |
| Protein Interactions |
FBXW11; WASL; ELAVL1; SAP30; HDAC1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF395 (ARP33162_P050) antibody |
| Blocking Peptide |
For anti-ZNF395 (ARP33162_P050) antibody is Catalog # AAP33162 (Previous Catalog # AAPP04195) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF395 |
| Uniprot ID |
Q9H8N7 |
| Protein Name |
Zinc finger protein 395 |
| Protein Accession # |
NP_061130 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018660 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF395 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 92%; Guinea Pig: 79%; Horse: 92%; Human: 100%; Mouse: 92%; Rat: 92% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF395 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate |
|
|
