| Product Number |
ARP33144_P050 |
| Product Page |
www.avivasysbio.com/znf654-antibody-middle-region-arp33144-p050.html |
| Name |
ZNF654 Antibody - middle region (ARP33144_P050) |
| Protein Size (# AA) |
299 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
55279 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 654 |
| Peptide Sequence |
Synthetic peptide located within the following region: TKSHRTFQAQCSFPECHELFEDLPLLYEHEAQHYLSKTPESSAQPSETIL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
The ZNF654 gene, located on chromosome 17, encodes a protein that is part of the zinc finger family. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF654 (ARP33144_P050) antibody |
| Blocking Peptide |
For anti-ZNF654 (ARP33144_P050) antibody is Catalog # AAP33144 (Previous Catalog # AAPP04177) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF654 |
| Uniprot ID |
Q9NV14 |
| Protein Name |
Zinc finger protein 654 |
| Protein Accession # |
NP_060763 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018293 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF654 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 82% |
| Image 1 | Human Liver
 | Human Liver |
| | Image 2 | Human Lung
 | WB Suggested Anti-ZNF654 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung |
|
|
