| Product Number |
ARP33141_T100 |
| Product Page |
www.avivasysbio.com/znf312-antibody-n-terminal-region-arp33141-t100.html |
| Name |
ZNF312 Antibody - N-terminal region (ARP33141_T100) |
| Protein Size (# AA) |
459 amino acids |
| Molecular Weight |
50kDa |
| NCBI Gene Id |
55079 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
FEZ family zinc finger 2 |
| Alias Symbols |
FEZ, TOF, FEZL, FKSG36, ZFP312, ZNF312 |
| Peptide Sequence |
Synthetic peptide located within the following region: MASSASLETMVPPACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hashimoto,H., et al., Mech. Dev. 97 (1-2), 191-195 (2000) |
| Description of Target |
ZNF312 is a candidate transcription factor |
| Protein Interactions |
HDAC1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FEZF2 (ARP33141_T100) antibody |
| Blocking Peptide |
For anti-FEZF2 (ARP33141_T100) antibody is Catalog # AAP33141 (Previous Catalog # AAPP04174) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF312 |
| Uniprot ID |
Q8TBJ5 |
| Protein Name |
Fez family zinc finger protein 2 |
| Protein Accession # |
NP_060478 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_018008 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FEZF2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF312 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
|
