CASZ1 Antibody - middle region (ARP33139_P050)

• Product Number: ARP33139_P050
• Name: CASZ1 Antibody - middle region (ARP33139_P050)
• Protein Size (# AA): 1166 amino acids
• Molecular Weight: 125kDa
• NCBI Gene Id: 54897
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Castor zinc finger 1
• Alias Symbols: CST, SRG, CAS11, ZNF693, dJ734G22.1
• Peptide Sequence: Synthetic peptide located within the following region: TPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Fernandez,F., (er) BMC Med. Genet. 8, 57 (2007)
• Description of Target: CASZ1 contains 8 C2H2-type zinc fingers.It is expressed in a number of human tumors and localizes to a chromosomal region frequently lost in tumors of neuroectodermal origin.
• Protein Interactions: EED; APP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CASZ1 (ARP33139_P050) antibody is Catalog # AAP33139 (Previous Catalog # AAPP04172)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CASZ1
• Uniprot ID: Q86V15-2
• Protein Name: Zinc finger protein castor homolog 1
• Protein Accession #: NP_060236
• Purification: Affinity Purified
• Nucleotide Accession #: NM_017766
• Tested Species Reactivity: Mouse
• Gene Symbol: CASZ1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 77%; Rat: 77%
• Image 1: Transfected 293T
  
  WB Suggested Anti-CASZ1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Transfected 293T
• Image 2: Mouse Pancreas
  
  Host: Mouse
  Target Name: CASZ1
  Sample Tissue: Mouse Pancreas
  Antibody Dilution: 1ug/ml