Product Number |
ARP33139_P050 |
Product Page |
www.avivasysbio.com/casz1-antibody-middle-region-arp33139-p050.html |
Name |
CASZ1 Antibody - middle region (ARP33139_P050) |
Protein Size (# AA) |
1166 amino acids |
Molecular Weight |
125kDa |
NCBI Gene Id |
54897 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Castor zinc finger 1 |
Alias Symbols |
CST, SRG, CAS11, ZNF693, dJ734G22.1 |
Peptide Sequence |
Synthetic peptide located within the following region: TPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Fernandez,F., (er) BMC Med. Genet. 8, 57 (2007) |
Description of Target |
CASZ1 contains 8 C2H2-type zinc fingers.It is expressed in a number of human tumors and localizes to a chromosomal region frequently lost in tumors of neuroectodermal origin. |
Protein Interactions |
EED; APP; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CASZ1 (ARP33139_P050) antibody |
Blocking Peptide |
For anti-CASZ1 (ARP33139_P050) antibody is Catalog # AAP33139 (Previous Catalog # AAPP04172) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CASZ1 |
Uniprot ID |
Q86V15-2 |
Protein Name |
Zinc finger protein castor homolog 1 |
Protein Accession # |
NP_060236 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_017766 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
CASZ1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 77%; Rat: 77% |
Image 1 | Transfected 293T
| WB Suggested Anti-CASZ1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T |
| Image 2 | Mouse Pancreas
| Host: Mouse Target Name: CASZ1 Sample Tissue: Mouse Pancreas Antibody Dilution: 1ug/ml |
|
|