| Product Number |
ARP33117_P050 |
| Product Page |
www.avivasysbio.com/tor3a-antibody-middle-region-arp33117-p050.html |
| Name |
TOR3A Antibody - middle region (ARP33117_P050) |
| Protein Size (# AA) |
397 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
64222 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Torsin family 3, member A |
| Description |
|
| Alias Symbols |
ADIR, ADIR2 |
| Peptide Sequence |
Synthetic peptide located within the following region: FHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Dron,M., (2002) Genomics 79 (3), 315-325 |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
UBC; TOR1A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TOR3A (ARP33117_P050) antibody |
| Blocking Peptide |
For anti-TOR3A (ARP33117_P050) antibody is Catalog # AAP33117 (Previous Catalog # AAPP04150) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TOR3A |
| Uniprot ID |
Q9H497 |
| Protein Name |
Torsin-3A |
| Publications |
Jungwirth, M., Dear, M. L., Brown, P., Holbrook, K. & Goodchild, R. Relative tissue expression of homologous torsinB correlates with the neuronal specific importance of DYT1 dystonia-associated torsinA. Hum. Mol. Genet. 19, 888-900 (2010). 20015956
The AAAâ+âATPase TorsinA polymerizes into hollow helical tubes with 8.5 subunits per turn. Nat Commun. 10, 3262 (2019). 31332180 |
| Protein Accession # |
NP_071766 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_022371 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TOR3A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%; Zebrafish: 83% |
| Image 1 | Human Fetal Liver
 | Host: Rabbit
Target Name: FAM46C
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml |
|
| Image 2 | Human HepG2
 | Host: Rabbit
Target Name: TOR3A
Sample Type: HepG2 Whole cell lysates
Antibody Dilution: 1.0ug/ml |
|
| Image 3 | Transfected 293T
 | WB Suggested Anti-TOR3A Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T |
|
