ARID4A antibody - C-terminal region (ARP33088_T100)
Data Sheet
 
Product Number ARP33088_T100
Product Page www.avivasysbio.com/arid4a-antibody-c-terminal-region-arp33088-t100.html
Product Name ARID4A antibody - C-terminal region (ARP33088_T100)
Size 100 ul
Gene Symbol ARID4A
Alias Symbols RBP1, RBBP1, RBP-1, RBBP-1
Protein Size (# AA) 1257 amino acids
Molecular Weight 143kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 5926
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name AT rich interactive domain 4A (RBP1-like)
Description This is a rabbit polyclonal antibody against ARID4A. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: NSSKCTPVKHLNVSKPQKLARSPARISPHIKDGEKDKHREKHPNSSPRTY
Target Reference Meehan,W.J., et al., (2004) J. Biol. Chem. 279 (2), 1562-1569
Description of Target ARID4A encodes a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein (pRB) which regulates cell proliferation. pRB represses transcription by recruiting the encoded protein. This protein, in turn, serves as a bridging molecule to recruit HDACs and, in addition, provides a second HDAC-independent repression function. The encoded protein possesses transcriptional repression activity. Multiple alternatively spliced transcripts have been observed for this gene, although not all transcript variants have been fully described.
Protein Interactions SUMO2; SUMO1; HDAC1; BRMS1; HIST2H3C; HIST4H4; UBC; CDK2; CDK1; CCNE1; CCNB1; CCNA2; CCND1; CDK4; SIN3A; SAP30; RB1; SIN3B; RBBP7; RBBP4; ARID4B; HDAC3; EID1; HDAC2; ING2; RBL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ARID4A (ARP33088_T100) antibody is Catalog # AAP33088 (Previous Catalog # AAPP04121)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ARID4A
Complete computational species homology data Anti-ARID4A (ARP33088_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ARID4A.
Swissprot Id P29374
Protein Name AT-rich interactive domain-containing protein 4A
Publications

Kondou, H. et al. Sodium-coupled neutral amino acid transporter 4 functions as a regulator of protein synthesis during liver development. Hepatol. Res. (2013). doi:10.1111/hepr.12069 WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 23607685

Protein Accession # NP_002883
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ARID4A.
Nucleotide Accession # NM_002892
Replacement Item This antibody may replace item sc-55746 from Santa Cruz Biotechnology.
Conjugation Options

ARP33088_T100-FITC Conjugated

ARP33088_T100-HRP Conjugated

ARP33088_T100-Biotin Conjugated

CB Replacement sc-55746; sc-55749; sc-62930; sc-62931; sc-81640
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Rat: 93%
Image 1
Human HepG2
WB Suggested Anti-ARID4A Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com