| Product Number |
ARP33065_T100 |
| Product Page |
www.avivasysbio.com/pou4f3-antibody-middle-region-arp33065-t100.html |
| Name |
POU4F3 Antibody - middle region (ARP33065_T100) |
| Protein Size (# AA) |
338 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
5459 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
POU class 4 homeobox 3 |
| Alias Symbols |
BRN3C, DFNA15, DFNA42, DFNA52 |
| Peptide Sequence |
Synthetic peptide located within the following region: ALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Weiss,S., et al., (2003) Mol. Cell. Biol. 23 (22), 7957-7964 |
| Description of Target |
POU4F3 is capable of activating both BDNF and NT-3 promoters in inner ear sensory epithelial cell lines. Mutant POU4F3 loses most of its transcriptional activity and most of its ability to bind to DNA. The mutation causes autosomal-dominant nonsyndromic hearing loss and eventually leads to hair cell morbidity in affected family members. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-POU4F3 (ARP33065_T100) antibody |
| Blocking Peptide |
For anti-POU4F3 (ARP33065_T100) antibody is Catalog # AAP33065 (Previous Catalog # AAPP04094) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human POU4F3 |
| Uniprot ID |
Q15319 |
| Protein Name |
POU domain, class 4, transcription factor 3 |
| Protein Accession # |
NP_002691 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002700 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
POU4F3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-POU4F3 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
|
| Image 2 | Human kidney
 | Human kidney |
|
| Image 3 | Mouse Brain
 | Host: Mouse
Target Name: POU4F1
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml |
|
