| Product Number |
ARP33061_T100 |
| Product Page |
www.avivasysbio.com/pou3f1-antibody-n-terminal-region-arp33061-t100.html |
| Name |
POU3F1 Antibody - N-terminal region (ARP33061_T100) |
| Protein Size (# AA) |
448 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
5453 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
POU class 3 homeobox 1 |
| Description |
|
| Alias Symbols |
OCT6, OTF6, SCIP |
| Peptide Sequence |
Synthetic peptide located within the following region: YLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEWL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Sumiyama,K., et al., (1998) Mamm. Genome 9 (2), 180-181 |
| Description of Target |
POU3F1 is a member of the POU domain family of proteins, and regulates events during neurogenesis and myelination. |
| Protein Interactions |
HMGA1; POU3F4; HMGB2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-POU3F1 (ARP33061_T100) antibody |
| Blocking Peptide |
For anti-POU3F1 (ARP33061_T100) antibody is Catalog # AAP33061 (Previous Catalog # AAPP05269) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human POU3F1 |
| Uniprot ID |
Q03052 |
| Protein Name |
POU domain, class 3, transcription factor 1 |
| Publications |
Hashimoto, Y. et al. Expression of organic anion-transporting polypeptide 1A2 and organic cation transporter 6 as a predictor of pathologic response to neoadjuvant chemotherapy in triple negative breast cancer. Breast Cancer Res. Treat. 145, 101-11 (2014). 24671357 |
| Protein Accession # |
NP_002690 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002699 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
POU3F1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-POU3F1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human kidney
 | Human kidney |
|
