TTRAP Antibody - middle region (ARP33010_P050)

Data Sheet
 
Product Number ARP33010_P050
Product Page www.avivasysbio.com/ttrap-antibody-middle-region-arp33010-p050.html
Name TTRAP Antibody - middle region (ARP33010_P050)
Protein Size (# AA) 362 amino acids
Molecular Weight 41kDa
NCBI Gene Id 51567
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tyrosyl-DNA phosphodiesterase 2
Description
Alias Symbols EAP2, AD022, EAPII, TTRAP, hTDP2, dJ30M3.3
Peptide Sequence Synthetic peptide located within the following region: IPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Pei,H., et al., (2003) Oncogene 22 (18), 2699-2709
Description of Target The TTRAP gene encodes a member of a superfamily of divalent cation-dependent phosphodiesterases. The encoded protein associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor associated factors (TRAFs), and inhibits nuclear factor-kappa-B activation. This protein has sequence and structural similarities with APE1 endonuclease, which is involved in both DNA repair and the activation of transcription factors.
Protein Interactions UBC; SRPK2; SUMO1; SUMO2; SUMO3; TAP1; SKIL; ATXN1; PSEN1; SMAD3; EPS8; DLX3; ATP5G2; C2orf88; JAM2; SNX13; AKAP9; RAB11A; PARK7; MAPK6; UBE2I; TRAF5; TRAF6; TRAF3; TRAF2; FLI1; TNFRSF1B; ETS2; ETS1; TNFRSF8; CD40; HTNVsSgp1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TDP2 (ARP33010_P050) antibody
Blocking Peptide For anti-TDP2 (ARP33010_P050) antibody is Catalog # AAP33010 (Previous Catalog # AAPP04039)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TTRAP
Uniprot ID O95551
Protein Name Tyrosyl-DNA phosphodiesterase 2
Publications

Epigenetic changes in histone acetylation underpin resistance to the topoisomerase I inhibitor irinotecan. Nucleic Acids Res. (2016). 27789688

Epigenetic changes in histone acetylation underpin resistance to the topoisomerase I inhibitor irinotecan. Nucleic Acids Res. 45, 1159-1176 (2017). 28180300

Xu, G.-L. et al. TTRAP is a novel PML nuclear bodies-associated protein. Biochem. Biophys. Res. Commun. 375, 395-8 (2008). 18706885

Sample Type Confirmation

TDP2 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_057698
Purification Affinity Purified
Nucleotide Accession # NM_016614
Tested Species Reactivity Human
Gene Symbol TDP2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Image 1
r-tdp2
Sample: 1. DT40 (5x105cells)
2. DT40 + rec. hTDP2 (5x105cells)
3. soluble HIS-hTDP2 (5x105cells)
4. pellet HIS-hTDP2 (5x105cells)
Primary dilution:1:1000
Secondary Antibody: dakocytomation Goat anti-rabbit
Secondary dilution: 1:5000
Image Submitted by: Keith Caldecott
University of Sussex 
Image 2
Human HepG2
WB Suggested Anti-TTRAP Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysateTDP2 is supported by BioGPS gene expression data to be expressed in HepG2
Image 3
Human kidney
Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com