LDB2 Antibody - N-terminal region (ARP33000_T100)

Data Sheet
 
Product Number ARP33000_T100
Product Page www.avivasysbio.com/ldb2-antibody-n-terminal-region-arp33000-t100.html
Name LDB2 Antibody - N-terminal region (ARP33000_T100)
Protein Size (# AA) 373 amino acids
Molecular Weight 43kDa
NCBI Gene Id 9079
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name LIM domain binding 2
Alias Symbols LDB1, CLIM1, LDB-2
Peptide Sequence Synthetic peptide located within the following region: DDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKES
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Retaux,S., et al., (1999) J. Neurosci. 19 (2), 783-793
Description of Target LDB2 belongs to the LDB family. LDB2 binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. LIM domains are required for both inhibitory effects on LIM homeodomain transcription factors and synergistic transcriptional activation events. The inhibitory actions of the LIM domain can often be overcome by the LIM co-regulators known as CLIM2, LDB2 and NLI. LIM homeoproteins and CLIMs are involved in a variety of developmental processes.
Protein Interactions LHX4; RILP; LMO3; RASIP1; SSBP3; SSBP2; LMO4; TSNAX; UBC; SSBP4; ISL1; LHX9; RLIM;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LDB2 (ARP33000_T100) antibody
Blocking Peptide For anti-LDB2 (ARP33000_T100) antibody is Catalog # AAP33000 (Previous Catalog # AAPP04029)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LDB2
Uniprot ID O43679
Protein Name LIM domain-binding protein 2
Protein Accession # NP_001281
Purification Protein A purified
Nucleotide Accession # NM_001290
Tested Species Reactivity Human
Gene Symbol LDB2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Lung
WB Suggested Anti-LDB2 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com