NR2F6 Antibody - middle region (ARP32995_T100)

Data Sheet
 
Product Number ARP32995_T100
Product Page www.avivasysbio.com/nr2f6-antibody-middle-region-arp32995-t100.html
Name NR2F6 Antibody - middle region (ARP32995_T100)
Protein Size (# AA) 404 amino acids
Molecular Weight 43kDa
NCBI Gene Id 2063
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Nuclear receptor subfamily 2, group F, member 6
Alias Symbols EAR2, EAR-2, ERBAL2
Peptide Sequence Synthetic peptide located within the following region: GLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Beausoleil,S.A., et al., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135
Description of Target NR2F6 is a nuclear orphan receptor that belongs to the COUP-TF subfamily
Protein Interactions NSD1; BCL11A; CBX1; NAP1L1; UBC; TFAP4; NR2F2; THRB; ANGPTL1; NCOA1; NR3C1; ESR1; NR2F6; RARG; RXRA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NR2F6 (ARP32995_T100) antibody
Blocking Peptide For anti-NR2F6 (ARP32995_T100) antibody is Catalog # AAP32995 (Previous Catalog # AAPP04024)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NR2F6
Uniprot ID P10588
Protein Name Nuclear receptor subfamily 2 group F member 6
Sample Type Confirmation

NR2F6 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_005225
Purification Protein A purified
Nucleotide Accession # NM_005234
Tested Species Reactivity Human
Gene Symbol NR2F6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Human HepG2
WB Suggested Anti-NR2F6 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysateNR2F6 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com