ZNF297B Antibody - middle region (ARP32978_P050)

Data Sheet
 
Product Number ARP32978_P050
Product Page www.avivasysbio.com/znf297b-antibody-middle-region-arp32978-p050.html
Name ZNF297B Antibody - middle region (ARP32978_P050)
Protein Size (# AA) 467 amino acids
Molecular Weight 53kDa
NCBI Gene Id 23099
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger and BTB domain containing 43
Alias Symbols ZNF-X, ZBTB22B, ZNF297B
Peptide Sequence Synthetic peptide located within the following region: QLTEHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHYTRPMYSKPSI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Description of Target ZNF297B is a new candidate transcription factor
Protein Interactions SYT6; LMO1; ARR3; FAM161A; AEN; DIP2A; ZBTB43; ZBTB24; MORF4L2; AP1M1; LMO4; PSMD3; MARCKSL1; MSLN; LAMTOR3; EIF4A1; BDP1; ELAVL1; ZNF417; TCEB3B; LNX1; LMO3; MCM10; TRAF2; ARRB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZBTB43 (ARP32978_P050) antibody
Blocking Peptide For anti-ZBTB43 (ARP32978_P050) antibody is Catalog # AAP32978 (Previous Catalog # AAPP04006)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZNF297B
Uniprot ID O43298
Protein Name Zinc finger and BTB domain-containing protein 43
Protein Accession # NP_054726
Purification Affinity Purified
Nucleotide Accession # NM_014007
Tested Species Reactivity Human
Gene Symbol ZBTB43
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Thymus
WB Suggested Anti-ZNF297B Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Thymus
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com