REXO4 Antibody - middle region (ARP32934_P050)

Data Sheet
 
Product Number ARP32934_P050
Product Page www.avivasysbio.com/rexo4-antibody-middle-region-arp32934-p050.html
Name REXO4 Antibody - middle region (ARP32934_P050)
Protein Size (# AA) 422 amino acids
Molecular Weight 47kDa
NCBI Gene Id 57109
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name REX4, RNA exonuclease 4 homolog (S. cerevisiae)
Alias Symbols REX4, XPMC2, XPMC2H
Peptide Sequence Synthetic peptide located within the following region: PADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
Description of Target The regulation of the quinone reductase (QR) gene as well as other genes involved in detoxification is known to be mediated by an electrophile response element (EpRE). QR gene regulation by the antiestrogen-occupied estrogen receptor (ER) is mediated by the EpRE-containing region of the human QR gene, and the ER is one of the complex of proteins that binds to the EpRE. REXO4 directly binds to the EpRE and interacts with the ER. The activation of QR gene activity by REXO4 is enhanced in the presence of ER beta.
Protein Interactions UBC; SIRT7; ESR2; ESR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-REXO4 (ARP32934_P050) antibody
Blocking Peptide For anti-REXO4 (ARP32934_P050) antibody is Catalog # AAP32934 (Previous Catalog # AAPP03958)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human REXO4
Uniprot ID Q9GZR2
Protein Name RNA exonuclease 4
Protein Accession # NP_065118
Purification Affinity Purified
Nucleotide Accession # NM_020385
Tested Species Reactivity Human
Gene Symbol REXO4
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Lung
WB Suggested Anti-REXO4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com