| Product Number |
ARP32929_T100 |
| Product Page |
http://www.avivasysbio.com/anti-psmc3-antibody-middle-region-arp32929-t100.html |
| Product Name |
PSMC3 antibody - middle region (ARP32929_T100) |
| Size |
100ug |
| Gene Symbol |
PSMC3 |
| Alias Symbols |
TBP1 |
| Nucleotide Accession# |
NM_002804 |
| Protein Accession# |
NP_002795 |
| Swissprot Id |
Q6IBS1 |
| Protein Size (# AA) |
439 amino acids |
| Molecular Weight |
45kDa |
| Subunit |
6A |
| Product Format |
Lyophilized powder |
| NCBI Gene Id |
5702 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Purification |
Protein A purified |
| Official Gene Full Name |
Proteasome (prosome, macropain) 26S subunit, ATPase, 3 |
| Description |
This is a rabbit polyclonal antibody against PSMC3. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com). |
| Peptide Sequence |
Synthetic peptide located within the following region: TKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILD |
| Key Reference |
Thompson,H.G., et al., (2004) Int. J. Cancer 111 (3), 338-347 |
| Description of Target |
PSMC3 is a subunit of the 26S proteasome. 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. This subunit may compete with PSMC2 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex. A pseudogene has been identified on chromosome 9 |
| Partner Proteins |
ESR1, ESR2, ESR1, ESR2 |
| Reconstitution and Storage |
Add 100 μl of distilled water. Final anti-PSMC3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Lead Time |
Domestic: within 24 hours delivery
International: 3-5 business days |
| Blocking Peptide |
For anti-PSMC3 antibody is Catalog # AAP32929 (Previous Catalog # AAPP03953) |
| Immunogen |
The immunogen for anti-PSMC3 antibody: synthetic peptide directed towards the middle region of human PSMC3 |
| Complete computational species homology data |
PSMC3 antibody - middle region (ARP32929_T100) |
| Tissue Tool |
Find tissues and cell lines supported to express PSMC3.  |
| Reviews and Data |
Computational species homology for PSMC3 antibody (ARP32929); Product Protocols: PSMC3 antibody tested by IHC with human kidney (ARP32929); Product Protocols: PSMC3 antibody tested with Human Hepg2 Cells (ARP32929_T100) |
| Homology Short |
Bovine, Chicken, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat, African clawed frog, Zebrafish |
| Observed Species Reactivity |
Human, Mouse, Dog, Rat, Chicken, Bovine, Zebrafish, African clawed frog |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; African clawed frog: 92%; Zebrafish: 92% |
| Image 1 | Human kidney
 | |
|
| Image 2 | Human HepG2
 | WB Suggested Anti-PSMC3 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
|
