RNF130 Antibody - N-terminal region (ARP32914_T100)

Data Sheet
 
Product Number ARP32914_T100
Product Page www.avivasysbio.com/rnf130-antibody-n-terminal-region-arp32914-t100.html
Name RNF130 Antibody - N-terminal region (ARP32914_T100)
Protein Size (# AA) 419 amino acids
Molecular Weight 46kDa
NCBI Gene Id 55819
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Ring finger protein 130
Alias Symbols GP, G1RP, G1RZFP, GOLIATH
Peptide Sequence Synthetic peptide located within the following region: QEPGRGAPLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Guais,A., et al., (2004) Biol. Reprod. 70 (1), 204-213
Description of Target RNF130 contains a RING finger motif and is similar to g1, a Drosophila zinc-finger protein that is expressed in mesoderm and involved in embryonic development. The expression of the mouse counterpart was found to be upregulated in myeloblastic cells following IL3 deprivation, suggesting that this gene may regulate growth factor withdrawal-induced apoptosis of myeloid precursor cells.
Protein Interactions UBE2E1; UBE2D3; UBE2D2; UBE2D1; UBC; MYC; UBE2E3; UBE2N; UBE2Z; UBE2D4; ARPC4; SCN2A; TGFBR1; FGFR3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RNF130 (ARP32914_T100) antibody
Blocking Peptide For anti-RNF130 (ARP32914_T100) antibody is Catalog # AAP32914 (Previous Catalog # AAPP03938)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RNF130
Uniprot ID Q86XS8
Protein Name E3 ubiquitin-protein ligase RNF130
Protein Accession # NP_060904
Purification Protein A purified
Nucleotide Accession # NM_018434
Tested Species Reactivity Human
Gene Symbol RNF130
Predicted Species Reactivity Human, Mouse, Rat, Cow, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Thymus
WB Suggested Anti-RNF130 Antibody Titration: 2.5ug/ml
Positive Control: Human Thymus
Image 2
Human Lung Tumor, Human Stomach Tumor
Host: Rabbit
Target: RNF130
Positive control (+): Human Lung Tumor (T-LU)
Negative control (-): Human Stomach Tumor (T-ST)
Antibody concentration: 3ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com