JMJD1A Antibody - C-terminal region (ARP32911_T100)

Data Sheet
 
Product Number ARP32911_T100
Product Page www.avivasysbio.com/jmjd1a-antibody-c-terminal-region-arp32911-t100.html
Name JMJD1A Antibody - C-terminal region (ARP32911_T100)
Protein Size (# AA) 1321 amino acids
Molecular Weight 147kDa
NCBI Gene Id 55818
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Lysine (K)-specific demethylase 3A
Alias Symbols TSGA, JMJD1, JHDM2A, JHMD2A, JMJD1A
Peptide Sequence Synthetic peptide located within the following region: HNLYSCIKVAEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Katoh,M. et al., (2003) Int. J. Mol. Med. 12 (5), 817-821
Description of Target JMJD1A is a zinc finger protein that contains a jumonji domain.
Protein Interactions RIPK2; HIST2H3C; CBX2; CBX4; AR; HIF1A; UBC; MYOCD; MKL1; MKL2; ETV2; TCEAL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KDM3A (ARP32911_T100) antibody
Blocking Peptide For anti-KDM3A (ARP32911_T100) antibody is Catalog # AAP32911 (Previous Catalog # AAPP03935)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD1A
Uniprot ID Q53S72
Protein Name Lysine-specific demethylase 3A
Publications

Zhou, X., Sun, H., Ellen, T. P., Chen, H. & Costa, M. Arsenite alters global histone H3 methylation. Carcinogenesis 29, 1831-6 (2008). 18321869

Sample Type Confirmation

KDM3A is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_060903
Purification Protein A purified
Nucleotide Accession # NM_018433
Tested Species Reactivity Human
Gene Symbol KDM3A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Human Smooth Muscle
Human Smooth Muscle
Image 2
Human kidney
Human kidney
Image 3
Human Jurkat
WB Suggested Anti-JMJD1A Antibody Titration: 1.0ug/ml
Positive Control: Jurkat cell lysateKDM3A is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com