FOXJ2 Antibody - middle region (ARP32910_T100)

Data Sheet
 
Product Number ARP32910_T100
Product Page www.avivasysbio.com/foxj2-antibody-middle-region-arp32910-t100.html
Name FOXJ2 Antibody - middle region (ARP32910_T100)
Protein Size (# AA) 574 amino acids
Molecular Weight 62kDa
NCBI Gene Id 55810
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Forkhead box J2
Alias Symbols FHX
Peptide Sequence Synthetic peptide located within the following region: SLQSPTSIASYSQGTGSVDGGAVAAGASGRESAEGPPPLYNTNHDFKFSY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Perez-Sanchez,C., et al., (2000) J. Mol. Biol. 301 (4), 795-806
Description of Target FOXJ2 is a fork head factor that is expressed in many adult tissues. In the embryo, FOXJ2 expression showed a very early onset during the cleavage stages of preimplantation development. It is capable of activating transcription from promoters containing its sites
Protein Interactions EGLN3; APP; ELAVL1; Nedd4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FOXJ2 (ARP32910_T100) antibody
Blocking Peptide For anti-FOXJ2 (ARP32910_T100) antibody is Catalog # AAP32910 (Previous Catalog # AAPP03934)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FOXJ2
Uniprot ID Q9P0K8
Protein Name Forkhead box protein J2
Protein Accession # NP_060886
Purification Protein A purified
Nucleotide Accession # NM_018416
Tested Species Reactivity Human
Gene Symbol FOXJ2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 85%; Rat: 85%
Image 1
Human HepG2
WB Suggested Anti-FOXJ2 Antibody Titration: 2.0ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human Stomach
Human Stomach
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com