Product Number |
ARP32910_T100 |
Product Page |
www.avivasysbio.com/foxj2-antibody-middle-region-arp32910-t100.html |
Name |
FOXJ2 Antibody - middle region (ARP32910_T100) |
Protein Size (# AA) |
574 amino acids |
Molecular Weight |
62kDa |
NCBI Gene Id |
55810 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Forkhead box J2 |
Alias Symbols |
FHX |
Peptide Sequence |
Synthetic peptide located within the following region: SLQSPTSIASYSQGTGSVDGGAVAAGASGRESAEGPPPLYNTNHDFKFSY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Perez-Sanchez,C., et al., (2000) J. Mol. Biol. 301 (4), 795-806 |
Description of Target |
FOXJ2 is a fork head factor that is expressed in many adult tissues. In the embryo, FOXJ2 expression showed a very early onset during the cleavage stages of preimplantation development. It is capable of activating transcription from promoters containing its sites |
Protein Interactions |
EGLN3; APP; ELAVL1; Nedd4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FOXJ2 (ARP32910_T100) antibody |
Blocking Peptide |
For anti-FOXJ2 (ARP32910_T100) antibody is Catalog # AAP32910 (Previous Catalog # AAPP03934) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FOXJ2 |
Uniprot ID |
Q9P0K8 |
Protein Name |
Forkhead box protein J2 |
Protein Accession # |
NP_060886 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_018416 |
Tested Species Reactivity |
Human |
Gene Symbol |
FOXJ2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 85%; Rat: 85% |
Image 1 | Human HepG2
| WB Suggested Anti-FOXJ2 Antibody Titration: 2.0ug/ml Positive Control: HepG2 cell lysate |
| Image 2 | Human Stomach
| Human Stomach |
|
|