HR Antibody - middle region (ARP32907_P050)

• Product Number: ARP32907_P050
• Name: HR Antibody - middle region (ARP32907_P050)
• Protein Size (# AA): 1189 amino acids
• Molecular Weight: 127kDa
• NCBI Gene Id: 55806
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Hairless homolog (mouse)
• Alias Symbols: AU, MUHH, ALUNC, HYPT4, MUHH1, HSA277165
• Peptide Sequence: Synthetic peptide located within the following region: RVWAPGDAGQQKESTQKTPPTPQPSCNGDTHRTKSIKEETPDSAETPAED
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Xie,Z., et al., (2006) Endocrinology 147 (1), 314-323
• Description of Target: HR is a protein whose function has been linked to hair growth. A similar protein in rat functions as a transcriptional corepressor for thyroid hormone and interacts with histone deacetylases. Mutations in this gene have been documented in cases of autosomal recessive congenital alopecia and atrichia with papular lesions.This gene encodes a protein whose function has been linked to hair growth. A similar protein in rat functions as a transcriptional corepressor for thyroid hormone and interacts with histone deacetylases. Mutations in this gene have been documented in cases of autosomal recessive congenital alopecia and atrichia with papular lesions. Two transcript variants encoding different isoforms have been found for this gene.
• Protein Interactions: VDR; TBL1X; TRIM27; RARB; RARA; HDAC1; HDAC5; HDAC3; HMGB1; HDAC2; THRA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HR (ARP32907_P050) antibody is Catalog # AAP32907 (Previous Catalog # AAPP03931)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HR
• Uniprot ID: O43593
• Protein Name: Protein hairless
• Protein Accession #: NP_005135
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005144
• Tested Species Reactivity: Human
• Gene Symbol: HR
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Dog: 85%; Human: 100%; Mouse: 77%; Pig: 85%; Rat: 77%
• Image 1: Human HepG2
  
  WB Suggested Anti-HR Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate
• Image 2: Human Skin
  
  Rabbit Anti-HR antibody
  Catalog Number: ARP32907
  Formalin Fixed Paraffin Embedded Tissue: Human Skin
  Primary antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20x
  Exposure Time: 0.5-2.0sec