C14ORF131 Antibody - middle region (ARP32906_T100)

• Product Number: ARP32906_T100
• Name: C14ORF131 Antibody - middle region (ARP32906_T100)
• Protein Size (# AA): 428 amino acids
• Molecular Weight: 46kDa
• NCBI Gene Id: 55778
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger protein 839
• Alias Symbols: C14orf131
• Peptide Sequence: Synthetic peptide located within the following region: KMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Scanlan,M.J., et al., (1999) Int. J. Cancer 83 (4), 456-464
• Description of Target: C14orf131 is a protein predicted based on an ORF found in chromosome 14.
• Protein Interactions: APP; YWHAZ; YWHAE;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF839 (ARP32906_T100) antibody is Catalog # AAP32906 (Previous Catalog # AAPP03930)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C14ORF131
• Uniprot ID: Q9Y595
• Protein Name: NY-REN-50 antigen EMBL AAD42878.1
• Sample Type Confirmation:

  ZNF839 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_060805
• Purification: Protein A purified
• Nucleotide Accession #: NM_018335
• Tested Species Reactivity: Human
• Gene Symbol: ZNF839
• Predicted Species Reactivity: Human, Cow, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 82%; Horse: 91%; Human: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-C14ORF131 Antibody Titration: 0.3-0.5ug/ml
  Positive Control: HepG2 cell lysateZNF839 is supported by BioGPS gene expression data to be expressed in HepG2