| Product Number |
ARP32899_P050 |
| Product Page |
www.avivasysbio.com/hszfp36-antibody-middle-region-arp32899-p050.html |
| Name |
HSZFP36 Antibody - middle region (ARP32899_P050) |
| Protein Size (# AA) |
397 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
55552 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 823 |
| Alias Symbols |
HSZFP36 |
| Peptide Sequence |
Synthetic peptide located within the following region: GKAFSLAGSLRRHEATHTGVKPYKCQCGKAFSDLSSFQNHETTHTGEKPY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
cDNA sequence of HSZFP36 is generated by Mammalian Gene Collection (MGC) Program Team. |
| Protein Interactions |
UBC; PAK1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF823 (ARP32899_P050) antibody |
| Blocking Peptide |
For anti-ZNF823 (ARP32899_P050) antibody is Catalog # AAP32899 (Previous Catalog # AAPP03923) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HSZFP36 |
| Uniprot ID |
Q6P4A9 |
| Protein Name |
Zinc finger protein 823 |
| Protein Accession # |
AAH63560 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001080493 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF823 |
| Predicted Species Reactivity |
Human, Rat |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rat: 79% |
| Image 1 | Human Liver
 | WB Suggested Anti-HSZFP36 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver |
|
|
