APTX Antibody - middle region (ARP32885_P050)

• Product Number: ARP32885_P050
• Name: APTX Antibody - middle region (ARP32885_P050)
• Protein Size (# AA): 306 amino acids
• Molecular Weight: 35kDa
• NCBI Gene Id: 54840
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Aprataxin
• Alias Symbols: AOA, AOA1, AXA1, EAOH, EOAHA, FHA-HIT
• Peptide Sequence: Synthetic peptide located within the following region: YPYIVEFEEEAKNPGLETHRKRKRSGNSDSIERDAAQEAEAGTGLEPGSN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Yoon,G., (2008) J. Neurol. Neurosurg. Psychiatr. 79 (2), 234-236
• Description of Target: APTX is a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined. This gene encodes a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined.
• Protein Interactions: PNMA1; UBC; SUMO1; NEDD8; LIG3; HSPA4; XRCC1; DDX21; CNTROB; TSPYL2; CALCOCO1; SYT17; ZNF639; MAPKBP1; CEP350; PICK1; XRCC4; TRIM37; MBP; HIVEP1; BANF1; PARP1; TP53;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-APTX (ARP32885_P050) antibody is Catalog # AAP32885 (Previous Catalog # AAPP03909)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APTX
• Uniprot ID: Q5T782
• Protein Name: Aprataxin
• Sample Type Confirmation:

  APTX is supported by BioGPS gene expression data to be expressed in HEK293T, HepG2

• Protein Accession #: NP_778239
• Purification: Affinity Purified
• Nucleotide Accession #: NM_175069
• Tested Species Reactivity: Human
• Gene Symbol: APTX
• Predicted Species Reactivity: Human, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Dog: 86%; Guinea Pig: 79%; Horse: 92%; Human: 100%; Rabbit: 86%
• Image 1: Human Muscle
  
  WB Suggested Anti-APTX Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Muscle
• Image 2: Human HepG2
  
  Host: Rabbit
  Target Name: APTX
  Sample Type: Human HepG2
  Antibody Dilution: 1.0ug/mlAPTX is supported by BioGPS gene expression data to be expressed in HepG2
• Image 3: Human 293T
  
  Host: Rabbit
  Target Name: APTX
  Sample Type: Human 293T
  Antibody Dilution: 1.0ug/mlAPTX is supported by BioGPS gene expression data to be expressed in HEK293T