DKFZP761C169 Antibody - N-terminal region (ARP32876_P050)

Data Sheet
 
Product Number ARP32876_P050
Product Page www.avivasysbio.com/dkfzp761c169-antibody-n-terminal-region-arp32876-p050.html
Name DKFZP761C169 Antibody - N-terminal region (ARP32876_P050)
Protein Size (# AA) 473 amino acids
Molecular Weight 52kDa
NCBI Gene Id 65056
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name GC-rich promoter binding protein 1
Alias Symbols GPBP, SSH6, VASCULIN
Peptide Sequence Synthetic peptide located within the following region: RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hsu,L.C., et al., (2003) Kidd,V.J., Mol. Cell. Biol. 23 (23), 8773-8785
Description of Target Vasculin is a novel vascular protein differentially expressed in human atherogenesis
Protein Interactions PLEKHF2; C20orf195; MCRS1; DNAL4; UBC; EP300;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GPBP1 (ARP32876_P050) antibody
Blocking Peptide For anti-GPBP1 (ARP32876_P050) antibody is Catalog # AAP32876 (Previous Catalog # AAPP03896)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DKFZP761C169
Uniprot ID Q86WP2
Protein Name Vasculin
Protein Accession # NP_075064
Purification Affinity Purified
Nucleotide Accession # NM_022913
Tested Species Reactivity Human
Gene Symbol GPBP1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
Image 1
Human HepG2
WB Suggested Anti-DKFZP761C169 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human kidney
Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com