Product Number |
ARP32876_P050 |
Product Page |
www.avivasysbio.com/dkfzp761c169-antibody-n-terminal-region-arp32876-p050.html |
Name |
DKFZP761C169 Antibody - N-terminal region (ARP32876_P050) |
Protein Size (# AA) |
473 amino acids |
Molecular Weight |
52kDa |
NCBI Gene Id |
65056 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
GC-rich promoter binding protein 1 |
Alias Symbols |
GPBP, SSH6, VASCULIN |
Peptide Sequence |
Synthetic peptide located within the following region: RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Hsu,L.C., et al., (2003) Kidd,V.J., Mol. Cell. Biol. 23 (23), 8773-8785 |
Description of Target |
Vasculin is a novel vascular protein differentially expressed in human atherogenesis |
Protein Interactions |
PLEKHF2; C20orf195; MCRS1; DNAL4; UBC; EP300; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GPBP1 (ARP32876_P050) antibody |
Blocking Peptide |
For anti-GPBP1 (ARP32876_P050) antibody is Catalog # AAP32876 (Previous Catalog # AAPP03896) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DKFZP761C169 |
Uniprot ID |
Q86WP2 |
Protein Name |
Vasculin |
Protein Accession # |
NP_075064 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_022913 |
Tested Species Reactivity |
Human |
Gene Symbol |
GPBP1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93% |
Image 1 | Human HepG2
| WB Suggested Anti-DKFZP761C169 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate |
| Image 2 | Human kidney
| Human kidney |
|
|