| Product Number |
ARP32872_T100 |
| Product Page |
www.avivasysbio.com/zbtb7c-antibody-n-terminal-region-arp32872-t100.html |
| Name |
ZBTB7C Antibody - N-terminal region (ARP32872_T100) |
| Protein Size (# AA) |
619 amino acids |
| Molecular Weight |
69kDa |
| NCBI Gene Id |
201501 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger and BTB domain containing 7C |
| Alias Symbols |
APM1, APM-1, ZBTB36, ZNF857C |
| Peptide Sequence |
Synthetic peptide located within the following region: MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Reuter,S., et al., (1991) J. Virol. 65 (10), 5564-5568 |
| Description of Target |
The function of Anti-ZBTB7C has not yet been determined. |
| Protein Interactions |
SREBF1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZBTB7C (ARP32872_T100) antibody |
| Blocking Peptide |
For anti-ZBTB7C (ARP32872_T100) antibody is Catalog # AAP32872 (Previous Catalog # AAPP03892) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB7C |
| Uniprot ID |
O73453 |
| Protein Name |
Zinc finger and BTB domain-containing protein 7C |
| Sample Type Confirmation |
ZBTB7C is supported by BioGPS gene expression data to be expressed in Raji |
| Protein Accession # |
NP_001034449 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001039360 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZBTB7C |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Human Raji
 | WB Suggested Anti-ZBTB7C Antibody Titration: 5.0ug/ml
Positive Control: Raji cell lysateZBTB7C is supported by BioGPS gene expression data to be expressed in Raji |
|
