ARID3A Antibody - middle region (ARP32869_P050)

• Product Number: ARP32869_P050
• Name: ARID3A Antibody - middle region (ARP32869_P050)
• Protein Size (# AA): 593 amino acids
• Molecular Weight: 63 kDa
• NCBI Gene Id: 1820
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: AT rich interactive domain 3A (BRIGHT-like)
• Alias Symbols: DRIL1, DRIL3, BRIGHT, E2FBP1
• Peptide Sequence: Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Fukuyo,Y., et al., (2004) Cell Death Differ. 11 (7), 747-759
• Description of Target: ARID3A is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It was found by its homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.
• Protein Interactions: NOTCH2NL; TTC32; UBC; SOX2; TP53BP1; APP; UBE2E3; TP53; SP100; PML; E2F4; E2F2; RL2; ELAVL1; SUMO2; BTK; E2F1; DSP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-ARID3A (ARP32869_P050) antibody is Catalog # AAP32869 (Previous Catalog # AAPP03889)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARID3A
• Uniprot ID: Q99856
• Protein Name: AT-rich interactive domain-containing protein 3A
• Sample Type Confirmation:

  ARID3A is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_005215
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005224
• Tested Species Reactivity: Human
• Gene Symbol: ARID3A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 77%
• Image 1: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.