| Product Number |
ARP32841_T100 |
| Product Page |
www.avivasysbio.com/ches1-antibody-c-terminal-region-arp32841-t100.html |
| Name |
CHES1 Antibody - C-terminal region (ARP32841_T100) |
| Protein Size (# AA) |
468 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
1112 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Forkhead box N3 |
| Alias Symbols |
CHES1, PRO1635, C14orf116 |
| Peptide Sequence |
Synthetic peptide located within the following region: SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yu,Y., et al., (2001) Genome Res. 11 (8), 1392-1403 |
| Description of Target |
Checkpoint suppressor 1 is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway. |
| Protein Interactions |
EXOSC8; SRPK2; ELAVL1; MEN1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FOXN3 (ARP32841_T100) antibody |
| Blocking Peptide |
For anti-FOXN3 (ARP32841_T100) antibody is Catalog # AAP32841 (Previous Catalog # AAPP03861) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CHES1 |
| Uniprot ID |
O00409 |
| Protein Name |
Forkhead box protein N3 |
| Publications |
Huot, G. et al. CHES1/FOXN3 regulates cell proliferation by repressing PIM2 and protein biosynthesis. Mol. Biol. Cell 25, 554-65 (2014). 24403608 |
| Sample Type Confirmation |
FOXN3 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_005188 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_005197 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FOXN3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-CHES1 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysateFOXN3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells |
|
