ALF Antibody - N-terminal region (ARP32837_P050)

Data Sheet
 
Product Number ARP32837_P050
Product Page www.avivasysbio.com/alf-antibody-n-terminal-region-arp32837-p050.html
Name ALF Antibody - N-terminal region (ARP32837_P050)
Protein Size (# AA) 453 amino acids
Molecular Weight 50kDa
NCBI Gene Id 11036
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name General transcription factor IIA, 1-like
Alias Symbols ALF
Peptide Sequence Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Upadhyaya,A.B., et al., (2002) J. Biol. Chem. 277 (37), 34208-34216
Description of Target The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involves the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. ALF is a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.
Protein Interactions GAB1; NKX2-3; ZBTB3; TLX3; MAFF; RBFOX2; HMG20A; PAX9; SIX6; MAFG; HOXC11; HOXC9; HOXA5; TLX2; EMX2; EMX1; CEBPE; ATF4; ASCL3; GTF2A2; SUB1; ID3; CSNK2A2; CSNK2A1; TBP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GTF2A1L (ARP32837_P050) antibody
Blocking Peptide For anti-GTF2A1L (ARP32837_P050) antibody is Catalog # AAP32837 (Previous Catalog # AAPP03857)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ALF
Uniprot ID Q9UNN4
Protein Name TFIIA-alpha and beta-like factor
Protein Accession # NP_751946
Purification Affinity Purified
Nucleotide Accession # NM_172196
Tested Species Reactivity Human
Gene Symbol GTF2A1L
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Rabbit: 91%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-ALF Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com