| Product Number |
ARP32828_P050 |
| Product Page |
www.avivasysbio.com/trafd1-antibody-c-terminal-region-arp32828-p050.html |
| Name |
TRAFD1 Antibody - C-terminal region (ARP32828_P050) |
| Protein Size (# AA) |
582 amino acids |
| Molecular Weight |
65kDa |
| NCBI Gene Id |
10906 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
TRAF-type zinc finger domain containing 1 |
| Alias Symbols |
FLN29 |
| Peptide Sequence |
Synthetic peptide located within the following region: TATNHVTEGIPRLDSQPQETSPELPRRRVRHQGDLSSGYLDDTKQETANG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
TRAFD1 is a new candidate transcription factor. |
| Protein Interactions |
NGLY1; UBC; TRAF6; CDK20; ILK; PAN2; HTT; VHL; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TRAFD1 (ARP32828_P050) antibody |
| Blocking Peptide |
For anti-TRAFD1 (ARP32828_P050) antibody is Catalog # AAP32828 (Previous Catalog # AAPP03847) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TRAFD1 |
| Uniprot ID |
O14545 |
| Protein Name |
TRAF-type zinc finger domain-containing protein 1 |
| Sample Type Confirmation |
TRAFD1 is strongly supported by BioGPS gene expression data to be expressed in Raji |
| Protein Accession # |
NP_006691 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006700 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TRAFD1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 86% |
| Image 1 | Human Raji
 | WB Suggested Anti-TRAFD1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Raji cell lysateTRAFD1 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells |
|
| Image 2 | Human kidney
 | Human kidney |
|
