AVIL Antibody - middle region (ARP32811_P050)

Data Sheet
 
Product Number ARP32811_P050
Product Page www.avivasysbio.com/avil-antibody-middle-region-arp32811-p050.html
Name AVIL Antibody - middle region (ARP32811_P050)
Protein Size (# AA) 819 amino acids
Molecular Weight 92kDa
NCBI Gene Id 10677
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Advillin
Alias Symbols p92, DOC6, ADVIL, NPHS21
Peptide Sequence Synthetic peptide located within the following region: PKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Piana,S., (2008) J. Mol. Biol. 375 (2), 460-470
Description of Target AVIL is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.
Protein Interactions UBC; CRK;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-AVIL (ARP32811_P050) antibody
Blocking Peptide For anti-AVIL (ARP32811_P050) antibody is Catalog # AAP32811 (Previous Catalog # AAPP03830)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human AVIL
Uniprot ID O75366
Protein Name Advillin
Protein Accession # NP_006567
Purification Affinity Purified
Nucleotide Accession # NM_006576
Tested Species Reactivity Human
Gene Symbol AVIL
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Image 1
Human Placenta
WB Suggested Anti-AVIL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com