| Product Number |
ARP32797_T100 |
| Product Page |
www.avivasysbio.com/scd-antibody-middle-region-arp32797-t100.html |
| Name |
SCD Antibody - middle region (ARP32797_T100) |
| Protein Size (# AA) |
359 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
6319 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Stearoyl-CoA desaturase (delta-9-desaturase) |
| Alias Symbols |
SCD1, FADS5, SCDOS, hSCD1, MSTP008 |
| Peptide Sequence |
Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Cohen,P.,et al., (2003) Curr. Drug Targets Immune Endocr. Metabol. Disord.3(4),271-280 |
| Description of Target |
Stearoyl-CoA desaturase ( fatty acid desaturase, SCD) is expressed at high levels in several human tissues and is required for the biosynthesis of oleate (18:1) and palmitoleate (16:1). These monounsaturated fatty acids are the major components of phospholipids, triglycerides, wax esters, and cholesterol esters. |
| Protein Interactions |
UBC; APP; VCP; ELAVL1; NEDD4L; CYB5A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SCD (ARP32797_T100) antibody |
| Blocking Peptide |
For anti-SCD (ARP32797_T100) antibody is Catalog # AAP32797 (Previous Catalog # AAPP03816) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SCD |
| Uniprot ID |
O00767 |
| Protein Name |
Acyl-CoA desaturase |
| Protein Accession # |
NP_005054 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_005063 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SCD |
| Predicted Species Reactivity |
Human, Cow, Dog, Goat, Guinea Pig, Sheep |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 85%; Goat: 85%; Guinea Pig: 85%; Human: 100%; Mouse: 77%; Rat: 77%; Sheep: 85% |
| Image 1 | HepG2, Human stomach
 | Host: Rabbit
Target: SCD
Positive control (+): HepG2 (HG)
Negative control (-): Human stomach (ST)
Antibody concentration: 0.5ug/ml |
|
| Image 2 | Human Jurkat
 | Host: Rabbit
Target Name: SCD
Sample Tissue: Human Jurkat
Antibody Dilution: 1.0ug/ml |
|
| Image 3 | Human Liver
 | Human Liver |
|
