ACAT2 Antibody - middle region (ARP32790_T100)

• Product Number: ARP32790_T100
• Name: ACAT2 Antibody - middle region (ARP32790_T100)
• Protein Size (# AA): 397 amino acids
• Molecular Weight: 41kDa
• NCBI Gene Id: 39
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Acetyl-CoA acetyltransferase 2
• Alias Symbols: ACAT2, ACTL
• Peptide Sequence: Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Sakashita, N., et al., (2003) Invest. 83 (11), 1569-1581
• Description of Target: Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
• Protein Interactions: CDKN2A; HBA1; CLU; SYK; BLOC1S6; SLC4A1AP; CA2; ANK1; RHAG; LYN; EPB41; CA4; CANX; SLC4A1; ACTC1; EPB42;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ACAT2 (ARP32790_T100) antibody is Catalog # AAP32790 (Previous Catalog # AAPP03809)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACAT2
• Uniprot ID: Q9BWD1
• Protein Name: Acetyl-CoA acetyltransferase, cytosolic
• Sample Type Confirmation:

  ACAT2 is supported by BioGPS gene expression data to be expressed in K562

• Protein Accession #: NP_005882
• Purification: Protein A purified
• Nucleotide Accession #: NM_005891
• Tested Species Reactivity: Human
• Gene Symbol: ACAT2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%
• Image 1: Human Liver
  
  Human Liver
• Image 2: Human K562
  
  WB Suggested Anti-ACAT2 Antibody Titration: 1.0ug/ml
  Positive Control: K562 cell lysateACAT2 is supported by BioGPS gene expression data to be expressed in K562
• Image 3: Mouse Liver, Mouse Heart
  
  Host: Rabbit
  Target: ACAT2
  Positive control (+): Mouse Liver (M-LI)
  Negative control (-): Mouse Heart (M-HE)
  Antibody concentration: 1ug/ml