ACADM Antibody - N-terminal region (ARP32789_T100)

Data Sheet
 
Product Number ARP32789_T100
Product Page www.avivasysbio.com/acadm-antibody-n-terminal-region-arp32789-t100.html
Name ACADM Antibody - N-terminal region (ARP32789_T100)
Protein Size (# AA) 421 amino acids
Molecular Weight 47kDa
NCBI Gene Id 34
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Acyl-CoA dehydrogenase, C-4 to C-12 straight chain
Alias Symbols MCAD, ACAD1, MCADH
Peptide Sequence Synthetic peptide located within the following region: ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Korsgren,C. et al., (2003) J Enzyme Inhib Med Chem 18 (5), 453-462
Description of Target ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency.
Protein Interactions SUMO2; SUMO3; UBC; MDM2; STRAP; HDAC1; UBD; CUL3; SUMO4; CALM1; USP50; USP20; ACADM;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ACADM (ARP32789_T100) antibody
Blocking Peptide For anti-ACADM (ARP32789_T100) antibody is Catalog # AAP32789 (Previous Catalog # AAPP03808)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ACADM
Uniprot ID P11310
Protein Name Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
Protein Accession # NP_000007
Purification Protein A purified
Nucleotide Accession # NM_000016
Tested Species Reactivity Human
Gene Symbol ACADM
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 83%; Yeast: 92%
Image 1
Human HepG2
WB Suggested Anti-ACADM Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com