ACSL1 Antibody - C-terminal region (ARP32784_P050)

• Product Number: ARP32784_P050
• Name: ACSL1 Antibody - C-terminal region (ARP32784_P050)
• Protein Size (# AA): 698 amino acids
• Molecular Weight: 78kDa
• NCBI Gene Id: 2180
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Acyl-CoA synthetase long-chain family member 1
• Alias Symbols: ACS1, LACS, FACL1, FACL2, LACS1, LACS2
• Peptide Sequence: Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ghosh,B., et al., (1995) Mol. Cell. Biochem. 151 (1), 77-81
• Description of Target: ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: SUMO2; PARK2; ATP4A; UBC; NR3C2; ECT2; UBD;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Paraffin embedded placenta tissue, tested with an antibody dilution of 5 ug/ml.
• Blocking Peptide: For anti-ACSL1 (ARP32784_P050) antibody is Catalog # AAP32784 (Previous Catalog # AAPP03803)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACSL1
• Uniprot ID: P33121
• Protein Name: Long-chain-fatty-acid--CoA ligase 1
• Publications:

  Golej, D. L. et al. Long-chain acyl-CoA synthetase 4 modulates prostaglandin E₂ release from human arterial smooth muscle cells. J. Lipid Res. 52, 782-93 (2011). 21242590

• Sample Type Confirmation:

  ACSL1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_001986
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001995
• Tested Species Reactivity: Human
• Gene Symbol: ACSL1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 85%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
• Image 1: Human HepG2
  
  WB Suggested Anti-ACSL1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate
• Image 2: Human pancreas
  
  heart, liver, pancreas, brain
• Image 3: Human kidney
  
  Human kidney
• Image 4: Human 721_B
  
  Human 721_B cellsACSL1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
• Image 5: Human Hela
  
  Human Hela
• Image 6: Hum. Fetal Brain
  
  Hum. Fetal Brain
• Image 7: Human Liver Tissue
  
  ACSL1 antibody - C-terminal region (ARP32784_P050)
  Catalog Number: ARP32784_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
  Observed Staining: Cytoplasm in hepatocytes
  Primary Antibody Concentration: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec