Product Number |
ARP32764_P050 |
Product Page |
www.avivasysbio.com/slc30a9-antibody-n-terminal-region-arp32764-p050.html |
Name |
SLC30A9 Antibody - N-terminal region (ARP32764_P050) |
Protein Size (# AA) |
568 amino acids |
Molecular Weight |
63kDa |
NCBI Gene Id |
10463 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Solute carrier family 30 (zinc transporter), member 9 |
Alias Symbols |
HUEL, ZNT9, GAC63, C4orf1, BILAPES |
Peptide Sequence |
Synthetic peptide located within the following region: LSQVKLYSTNVQKEGQGSQTLRVEKVPSFETAEGIGTELKAPLKQEPLQV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sim, et al., (2002) Int. J. Biochem. Cell Biol. 34 (5), 487-504 |
Description of Target |
HUEL includes the putative nuclear receptor interaction motif, nuclear localization and export signals, zinc finger, leucine zipper and acidic domains. HUEL is likely to be an evolutionarily conserved, housekeeping gene that plays a role intimately linked with cellular replication, DNA synthesis and/or transcriptional regulation. |
Protein Interactions |
DHX15; ELAVL1; UBC; NCOA2; ESR1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLC30A9 (ARP32764_P050) antibody |
Blocking Peptide |
For anti-SLC30A9 (ARP32764_P050) antibody is Catalog # AAP32764 (Previous Catalog # AAPP03779) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC30A9 |
Uniprot ID |
Q6PML9 |
Protein Name |
Zinc transporter 9 |
Protein Accession # |
NP_006336 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006345 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC30A9 |
Predicted Species Reactivity |
Human, Rat, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Rabbit: 79%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-SLC30A9 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate |
|