OLIG2 Antibody - N-terminal region (ARP32752_P050)

• Product Number: ARP32752_P050
• Name: OLIG2 Antibody - N-terminal region (ARP32752_P050)
• Protein Size (# AA): 323 amino acids
• Molecular Weight: 32kDa
• NCBI Gene Id: 10215
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Oligodendrocyte lineage transcription factor 2
• Alias Symbols: BHLHB1, OLIGO2, RACK17, PRKCBP2, bHLHe19
• Peptide Sequence: Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mitkus,S.N., Schizophr. Res. 98 (1-3), 129-138 (2008)
• Description of Target: OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: CUL3; SRRM1; SOX8; NKX2-2; EP300; SOX10;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-OLIG2 (ARP32752_P050) antibody is Catalog # AAP32752 (Previous Catalog # AAPP03766)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OLIG2
• Uniprot ID: Q13516
• Protein Name: Oligodendrocyte transcription factor 2
• Protein Accession #: NP_005797
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005806
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: OLIG2
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Image 1: Mouse Heart
  
  Host: Mouse
  Target Name: OLIG2
  Sample Tissue: Mouse Heart
  Antibody Dilution: 1ug/ml
• Image 2: Mouse Heart
  
  Host: Rabbit
  Target Name: OLIG2
  Sample Tissue: Mouse Heart
  Antibody Dilution: 1ug/ml
• Image 3: Human HepG2
  
  WB Suggested Anti-OLIG2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate
• Image 4: Human optic nerve
  
  Sample Type: Human Optic Nerve and Spinal CordCellular Target: Oligoden Drocyte Lineage CellsDilution: 1:500