ZFP67 Antibody - middle region (ARP32749_T100)

Data Sheet
 
Product Number ARP32749_T100
Product Page www.avivasysbio.com/zfp67-antibody-middle-region-arp32749-t100.html
Name ZFP67 Antibody - middle region (ARP32749_T100)
Protein Size (# AA) 539 amino acids
Molecular Weight 58kDa
NCBI Gene Id 51043
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger and BTB domain containing 7B
Alias Symbols CKROX, THPOK, ZFP67, ZBTB15, ZFP-67, c-KROX, hcKROX, ZNF857B
Peptide Sequence Synthetic peptide located within the following region: DLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKLP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Widom, R.L., et al., (1997) Gene 198 (1-2), 407-420
Description of Target ZFP67 is an early growth response gene that encodes a zinc finger-containing transcription factor that binds to the promoter regions of type I collagen genes and has a role in development.
Protein Interactions SYTL4; IMP4; SH3KBP1; SH3YL1; SORBS3; ZBTB5; MORF4L2; NCK2; RPL9; PIN1; GRB2; BCL6; NDN; KAT5; RNF2; KPNA2; HDAC10; HDAC5; HDAC4; HDAC3; Zbtb7a; TFAP4; RELA; ZBTB7B; HSPH1; PRPF8; MYBBP1A; CEBPZ; UBC; EP300; SP3; SP1; ZNF277; GRAP2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZBTB7B (ARP32749_T100) antibody
Blocking Peptide For anti-ZBTB7B (ARP32749_T100) antibody is Catalog # AAP32749 (Previous Catalog # AAPP03763)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZFP67
Uniprot ID O15156
Protein Name Zinc finger and BTB domain-containing protein 7B
Protein Accession # NP_056956
Purification Protein A purified
Nucleotide Accession # NM_015872
Tested Species Reactivity Human
Gene Symbol ZBTB7B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 86%
Image 1
Human Lung
Human Lung
Image 2
Human Heart
Human Heart
Image 3
Human Fetal Liver
Host: Rabbit
Target Name: ZFP67
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml
Image 4
HepG2
Host: Rabbit
Target Name: ZFP67
Sample Type: HepG2
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 1.25ug/mL
Peptide Concentration: 1.0ug/mL
Lysate Quantity: 25ug/lane
Gel Concentration: 12%
Image 5
Human HepG2
WB Suggested Anti-ZFP67 Antibody Titration: 1.0-2.0ug/ml
Positive Control: HepG2 cell lysate
Image 6
Human lung, 293T
Host: Rabbit
Target: ZBTB7B
Positive control (+): Human lung (LU)
Negative control (-): 293T (2T)
Antibody concentration: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com