MYEF2 Antibody - middle region (ARP32738_P050)

Data Sheet
 
Product Number ARP32738_P050
Product Page www.avivasysbio.com/myef2-antibody-middle-region-arp32738-p050.html
Name MYEF2 Antibody - middle region (ARP32738_P050)
Protein Size (# AA) 600 amino acids
Molecular Weight 64kDa
NCBI Gene Id 50804
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Myelin expression factor 2
Alias Symbols MEF-2, MST156, myEF-2, MSTP156, HsT18564
Peptide Sequence Synthetic peptide located within the following region: QAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gossett,L.A., et al., (1989) Mol. Cell. Biol. 9 (11), 5022-5033
Description of Target MEF-2 is expressed early in the differentiation program and is suppressed by specific polypeptide growth factors. The ability of MEF-2 to recognize conserved activating elements associated with multiple-specific genes suggests that this factor may participate in the coordinate regulation of genes during myogenesis.
Protein Interactions COG8; TEX11; TRAF1; GOLGA2; UBC; EED; RNF2; BMI1; SOX2; CDK19; SIRT7; TADA2A; ATXN1; PPARGC1A; HDAC5; MAPK14; tat; SMARCA4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MYEF2 (ARP32738_P050) antibody
Blocking Peptide For anti-MYEF2 (ARP32738_P050) antibody is Catalog # AAP32738 (Previous Catalog # AAPP03752)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MYEF2
Uniprot ID Q9P2K5
Protein Name Myelin expression factor 2
Protein Accession # NP_057216
Purification Affinity Purified
Nucleotide Accession # NM_016132
Tested Species Reactivity Human, Mouse
Gene Symbol MYEF2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Mouse Testis
Host: Mouse
Target Name: MYEF2
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml
Image 2
Human Lung
Rabbit Anti-MYEF2 Antibody
Catalog Number: ARP32738
Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
Human 786-0
Host: Rabbit
Target Name: MYEF2
Sample Tissue: Human 786-0
Antibody Dilution: 1.0ug/ml
Image 4
Human Lung
Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com