PAX3 Antibody - C-terminal region (ARP32736_P050)

Data Sheet
 
Product Number ARP32736_P050
Product Page www.avivasysbio.com/pax3-antibody-c-terminal-region-arp32736-p050.html
Name PAX3 Antibody - C-terminal region (ARP32736_P050)
Protein Size (# AA) 479 amino acids
Molecular Weight 53kDa
NCBI Gene Id 5077
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Paired box 3
Alias Symbols WS1, WS3, CDHS, HUP2
Peptide Sequence Synthetic peptide located within the following region: GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Blake,J.A. (2005) Dev. Growth Differ. 47 (9), 627-635
Description of Target PAX3 is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma.This gene is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini.
Protein Interactions PCTP; UBC; TAF1; POU3F2; HDAC1; TRIM28; HDAC10; SOX8; WWTR1; PAX3; DAXX; CIB1; SOX10; MEOX2; MEOX1; MITF; MSX1; Rad23b; PSMD4; TBP; IPO13; CNR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PAX3 (ARP32736_P050) antibody
Blocking Peptide For anti-PAX3 (ARP32736_P050) antibody is Catalog # AAP32736 (Previous Catalog # AAPP03750)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PAX3
Uniprot ID P23760
Protein Name Paired box protein Pax-3
Protein Accession # NP_852122
Purification Affinity Purified
Nucleotide Accession # NM_181457
Tested Species Reactivity Human, Mouse
Gene Symbol PAX3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Human Lung
WB Suggested Anti-PAX3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung
Image 2
Mouse B16F10
Sample Type:
Mouse B16F10
Primary Antibody Dilution:
1:200
Secondary Antibody:
Goat anti-rabbit-FITC
Secondary Antibody Dilution:
1:800
Color/Signal Descriptions:
Green: FITC Blue: DAPI
Gene Name:
PAX3
Submitted by:
Tsu Fang Wu, Institute of Molecular Biology, National Chung Hsing University
Image 3
Human HEK293, A375, A2058, Mouse, B16F10
WB Suggested Anti-PAX3 Antibody
Positive Control: Lane 1: Flag-PAX3(overexpression, human), HEK293, 50?g. Lane 2: Mouse, B16F10, 50?g. Lane 3: Human, A375, 50?g. Lane 4: Human, A2058, 50?g
Primary Antibody Dilution : 1:5000
Secondary Antibody : Goat anti-rabbit AP
Secondry Antibody Dilution : 1:5000
Submitted by: Tsu Fang Wu, Institute of Molecular Biology, National Chung Hsing University
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com