PAWR Antibody - middle region (ARP32735_T100)

Data Sheet
 
Product Number ARP32735_T100
Product Page www.avivasysbio.com/pawr-antibody-middle-region-arp32735-t100.html
Name PAWR Antibody - middle region (ARP32735_T100)
Protein Size (# AA) 340 amino acids
Molecular Weight 37kDa
NCBI Gene Id 5074
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name PRKC, apoptosis, WT1, regulator
Alias Symbols PAR4, Par-4
Peptide Sequence Synthetic peptide located within the following region: SYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Bergmann,M., et al., (2004) Ann.Hematol.83(10),646-653
Description of Target The tumor suppressor WT1 represses and activates transcription. Anti-Prostate Apoptosis Response Protein Par-4 (PAWR) is a WT1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger DNA binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells.
Protein Interactions FBXO45; UBC; EED; FAM129B; SNX6; CAND1; VPS29; JMJD6; STAT1; SNX2; SHMT2; SHMT1; PPM1G; IDE; H3F3A; CARS; ATP6V1C1; APEH; PAN2; DRD2; DAPK3; SQSTM1; PRKCZ; Spsb4; Spsb2; SPSB1; FBXO25; HSPA5; Cep350; Kif23; THAP1; SLC5A7; AATF; TFPT; PAWR; WT1; RRAS2; ATP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PAWR (ARP32735_T100) antibody
Blocking Peptide For anti-PAWR (ARP32735_T100) antibody is Catalog # AAP32735 (Previous Catalog # AAPP03749)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PAWR
Uniprot ID O75796
Protein Name PRKC apoptosis WT1 regulator protein
Protein Accession # NP_002574
Purification Protein A purified
Nucleotide Accession # NM_002583
Tested Species Reactivity Human
Gene Symbol PAWR
Predicted Species Reactivity Human, Mouse, Rat, Dog, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Horse: 85%; Human: 100%; Mouse: 91%; Rabbit: 77%; Rat: 91%
Image 1
Human Liver
Human Liver
Image 2
Human kidney
Human kidney
Image 3
Human Jurkat
WB Suggested Anti-PAWR Antibody Titration: 0.5-1.0ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com