NOTCH4 Antibody - middle region (ARP32726_P050)

Data Sheet
 
Product Number ARP32726_P050
Product Page www.avivasysbio.com/notch4-antibody-middle-region-arp32726-p050.html
Name NOTCH4 Antibody - middle region (ARP32726_P050)
Protein Size (# AA) 589 amino acids
Molecular Weight 61kDa
NCBI Gene Id 4855
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Notch 4
Alias Symbols INT3
Peptide Sequence Synthetic peptide located within the following region: LLLGLGAARELRDQAGLAPADVAHQRNHWDLLTLLEGAGPPEARHKATPG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sugaya K., et al., (1997) Gene 189:235-244
Description of Target NOTCH4 is a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. NOTCH4 is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. NOTCH4 functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. NOTCH4 gene may be associated with susceptibility to schizophrenia in a small portion of cases.
Protein Interactions EGFL7; Dlg4; SMAD4; SMAD3; SMAD2; TCEB1; UBC; TP53; MDM2; MAML3; MAML2; FBXW7; MAML1; DLL4; PSEN2; NOTCH4; RBPJ; PSEN1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NOTCH4 (ARP32726_P050) antibody
Blocking Peptide For anti-NOTCH4 (ARP32726_P050) antibody is Catalog # AAP32726 (Previous Catalog # AAPP03740)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NOTCH4
Uniprot ID Q99466-2
Protein Name Neurogenic locus notch homolog protein 4
Publications

Notch-Induced Expression of FZD7 Requires Noncanonical NOTCH3 Signaling in Human Breast Epithelial Cells. Stem Cells Dev. 25, 522-9 (2016). 26847503

Sun, Y. et al. Trp53 regulates Notch 4 signaling through Mdm2. J. Cell Sci. 124, 1067-76 (2011). 21402876

Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol NOTCH4
Predicted Species Reactivity Human, Rat, Cow, Guinea Pig, Horse, Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Pig: 100%; Rat: 93%
Image 1
Human Breast
Immunohistochemistry with Human Breast tissue at an antibody concentration of 5.0ug/ml using anti-NOTCH4 antibody (ARP32726_P050)
Image 2
Human Lung Tumor
Host: Rabbit
Target Name: NOTCH4
Sample Tissue: Human Lung Tumor
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com