| Product Number |
ARP32715_T100 |
| Product Page |
www.avivasysbio.com/nfatc4-antibody-middle-region-arp32715-t100.html |
| Name |
NFATC4 Antibody - middle region (ARP32715_T100) |
| Protein Size (# AA) |
902 amino acids |
| Molecular Weight |
95kDa |
| NCBI Gene Id |
4776 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4 |
| Alias Symbols |
NFAT3, NF-AT3, NF-ATC4 |
| Peptide Sequence |
Synthetic peptide located within the following region: GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Zhang,H., (2005) J. Biol. Chem. 280 (52), 43188-43197 |
| Description of Target |
NFATC4 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. NFATC4 plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. The product of this gene plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4. |
| Protein Interactions |
ANKRD28; Dlg4; NR1I2; MAPK9; MAPK8; JUP; GPR22; CCNG1; LPIN1; CEBPA; GATA4; YWHAZ; MAPK14; CREBBP; YWHAQ; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NFATC4 (ARP32715_T100) antibody |
| Blocking Peptide |
For anti-NFATC4 (ARP32715_T100) antibody is Catalog # AAP32715 (Previous Catalog # AAPP03729) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NFATC4 |
| Uniprot ID |
Q14934 |
| Protein Name |
Nuclear factor of activated T-cells, cytoplasmic 4 |
| Protein Accession # |
NP_004545 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_004554 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NFATC4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 82% |
| Image 1 | Human Muscle
 | Human Muscle |
|
| Image 2 | Transfected 293T
 | WB Suggested Anti-NFATC4 Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T |
|
