MEOX2 Antibody - N-terminal region (ARP32698_T100)

Data Sheet
 
Product Number ARP32698_T100
Product Page www.avivasysbio.com/meox2-antibody-n-terminal-region-arp32698-t100.html
Name MEOX2 Antibody - N-terminal region (ARP32698_T100)
Protein Size (# AA) 303 amino acids
Molecular Weight 33kDa
NCBI Gene Id 4223
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Mesenchyme homeobox 2
Alias Symbols GAX, MOX2
Peptide Sequence Synthetic peptide located within the following region: ATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
Description of Target MEOX2 is a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. MEOX2 may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease.
Protein Interactions ZNF564; ZNF483; TTC39B; LOC153684; ZMAT2; ZNF417; KRT80; DYNLL2; ZNF572; AHSA2; HEXIM2; MSI2; CIB3; MRFAP1L1; IGFN1; TRIM41; KLC4; FBF1; KRTAP4-2; KRTAP4-7; MUM1; ZNF587; PGBD1; EIF1AD; HDHD2; NCALD; KRTAP9-2; TTC25; ADAMTS12; DOCK8; ZNF329; SCNM1; RMND5A
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MEOX2 (ARP32698_T100) antibody
Blocking Peptide For anti-MEOX2 (ARP32698_T100) antibody is Catalog # AAP32698 (Previous Catalog # AAPP03712)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MEOX2
Uniprot ID Q6FHY5
Protein Name MEOX2 protein EMBL CAG38790.1
Protein Accession # NP_005915
Purification Protein A purified
Nucleotide Accession # NM_005924
Tested Species Reactivity Human
Gene Symbol MEOX2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Transfected 293T
WB Suggested Anti-MEOX2 Antibody Titration: 2.5ug/ml
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com