HSF4 Antibody - middle region (ARP32652_T100)

Data Sheet
 
Product Number ARP32652_T100
Product Page www.avivasysbio.com/hsf4-antibody-middle-region-arp32652-t100.html
Name HSF4 Antibody - middle region (ARP32652_T100)
Protein Size (# AA) 463 amino acids
Molecular Weight 50kDa
NCBI Gene Id 3299
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Heat shock transcription factor 4
Alias Symbols CTM, CTRCT5
Peptide Sequence Synthetic peptide located within the following region: VTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSCPT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
Description of Target Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described.
Protein Interactions SESTD1; MYO15A; TIMM13; SUGT1; RABEP1; TARBP1; HSF2; HSF1; FKBP5; DUSP26; MAPK1; SUMO1; ZBED8; NUDT21; CDK2AP2; BCL6; SMARCA4; SLC27A5; HSF4; MAPK3; MAPK8; MAPK14;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HSF4 (ARP32652_T100) antibody
Blocking Peptide For anti-HSF4 (ARP32652_T100) antibody is Catalog # AAP32652 (Previous Catalog # AAPP03662)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HSF4
Uniprot ID Q9ULV5-2
Protein Name Heat shock factor protein 4
Protein Accession # NP_001529
Purification Protein A purified
Nucleotide Accession # NM_001538
Tested Species Reactivity Human
Gene Symbol HSF4
Predicted Species Reactivity Human, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Rabbit: 92%
Image 1
Human HepG2
WB Suggested Anti-HSF4 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com