| Product Number |
ARP32647_T100 |
| Product Page |
www.avivasysbio.com/hoxd12-antibody-n-terminal-region-arp32647-t100.html |
| Name |
HOXD12 Antibody - N-terminal region (ARP32647_T100) |
| Protein Size (# AA) |
279 amino acids |
| Molecular Weight |
30kDa |
| NCBI Gene Id |
3238 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Homeobox D12 |
| Alias Symbols |
HOX4H |
| Peptide Sequence |
Synthetic peptide located within the following region: MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Goodman,F.R. et al., (2002) Am. J. Med. Genet. 112 (3), 256-265 |
| Description of Target |
HOXD12 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined. |
| Protein Interactions |
TRAF1; CREBBP; MAFF; MAFG; MEIS1; MAFB; MAFK; MAF; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HOXD12 (ARP32647_T100) antibody |
| Blocking Peptide |
For anti-HOXD12 (ARP32647_T100) antibody is Catalog # AAP32647 (Previous Catalog # AAPP03657) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXD12 |
| Uniprot ID |
P35452 |
| Protein Name |
Homeobox protein Hox-D12 |
| Publications |
Illig, R., Fritsch, H. & Schwarzer, C. Spatio-temporal expression of HOX genes in human hindgut development. Dev. Dyn. 242, 53-66 (2013). 23073994 |
| Protein Accession # |
NP_067016 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_021193 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HOXD12 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Smooth Muscle
 | Human Smooth Muscle |
|
| Image 2 | Human Muscle
 | WB Suggested Anti-HOXD12 Antibody Titration: 5.0ug/ml
Positive Control: Human Muscle |
|
