HOXB9 Antibody - N-terminal region (ARP32639_P050)

Data Sheet
 
Product Number ARP32639_P050
Product Page www.avivasysbio.com/hoxb9-antibody-n-terminal-region-arp32639-p050.html
Name HOXB9 Antibody - N-terminal region (ARP32639_P050)
Protein Size (# AA) 250 amino acids
Molecular Weight 28 kDa
NCBI Gene Id 3219
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Homeobox B9
Alias Symbols HOX2, HOX2E, HOX-2.5
Peptide Sequence Synthetic peptide located within the following region: SPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Apiou, F., et al., (1996) Cytogenet. Cell Genet. 73 (1-2), 114-115
Description of Target HOXB9 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. HOXB9 is one of several homeobox HOXB genes located in a cluster on chromosome 17. The exact role of this gene has yet to be determined.
Protein Interactions KRTAP10-9; MID2; CALCOCO2; PNMA1; TRIP6; SAT1; KRTAP5-9; GOLGA2; MDFI; TAL1; ECT2; UBC; CREBBP; SPZ1; HOPX; ZNF408; ING4; PHTF1; MYBBP1A; SOX15; BTG1; KRTAP4-12; RBPMS; EP300; BTG2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HOXB9 (ARP32639_P050) antibody
Blocking Peptide For anti-HOXB9 (ARP32639_P050) antibody is Catalog # AAP32639 (Previous Catalog # AAPP03649)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB9
Uniprot ID P17482
Protein Name Homeobox protein Hox-B9
Protein Accession # NP_076922
Purification Affinity Purified
Nucleotide Accession # NM_024017
Tested Species Reactivity Human
Gene Symbol HOXB9
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 100%; Rat: 79%
Image 1
Human Lung
Human Lung
Image 2
Human Heart
Human Heart
Image 3
Human Fetal Liver
Host: Rabbit
Target Name: HOXB9
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml
Image 4
Human Lung
Rabbit Anti-HOXB9 Antibody
Catalog Number: ARP32639
Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 5

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com