Product Number |
ARP32637_P050 |
Product Page |
www.avivasysbio.com/hoxa7-antibody-n-terminal-region-arp32637-p050.html |
Name |
HOXA7 Antibody - N-terminal region (ARP32637_P050) |
Protein Size (# AA) |
230 amino acids |
Molecular Weight |
25kDa |
NCBI Gene Id |
3204 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Homeobox A7 |
Alias Symbols |
ANTP, HOX1, HOX1A, HOX1.1 |
Peptide Sequence |
Synthetic peptide located within the following region: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFAST |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Leroy,P., et al., (2004) J. Leukoc. Biol. 75 (4), 680-688 |
Description of Target |
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA7 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. |
Protein Interactions |
PEX5; NPM1; JUNB; UBC; GMNN; MEIS1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HOXA7 (ARP32637_P050) antibody |
Blocking Peptide |
For anti-HOXA7 (ARP32637_P050) antibody is Catalog # AAP32637 (Previous Catalog # AAPP03647) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXA7 |
Uniprot ID |
P31268 |
Protein Name |
Homeobox protein Hox-A7 |
Sample Type Confirmation |
HOXA7 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_008827 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006896 |
Tested Species Reactivity |
Human |
Gene Symbol |
HOXA7 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-HOXA7 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysateHOXA7 is supported by BioGPS gene expression data to be expressed in Jurkat |
|