HOXA7 Antibody - N-terminal region (ARP32637_P050)

Data Sheet
 
Product Number ARP32637_P050
Product Page www.avivasysbio.com/hoxa7-antibody-n-terminal-region-arp32637-p050.html
Name HOXA7 Antibody - N-terminal region (ARP32637_P050)
Protein Size (# AA) 230 amino acids
Molecular Weight 25kDa
NCBI Gene Id 3204
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Homeobox A7
Alias Symbols ANTP, HOX1, HOX1A, HOX1.1
Peptide Sequence Synthetic peptide located within the following region: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFAST
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Leroy,P., et al., (2004) J. Leukoc. Biol. 75 (4), 680-688
Description of Target In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA7 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation.
Protein Interactions PEX5; NPM1; JUNB; UBC; GMNN; MEIS1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HOXA7 (ARP32637_P050) antibody
Blocking Peptide For anti-HOXA7 (ARP32637_P050) antibody is Catalog # AAP32637 (Previous Catalog # AAPP03647)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HOXA7
Uniprot ID P31268
Protein Name Homeobox protein Hox-A7
Sample Type Confirmation

HOXA7 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_008827
Purification Affinity Purified
Nucleotide Accession # NM_006896
Tested Species Reactivity Human
Gene Symbol HOXA7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-HOXA7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateHOXA7 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com