FOXA1 Antibody - C-terminal region (ARP32630_P050)

Data Sheet
 
Product Number ARP32630_P050
Product Page www.avivasysbio.com/foxa1-antibody-c-terminal-region-arp32630-p050.html
Name FOXA1 Antibody - C-terminal region (ARP32630_P050)
Protein Size (# AA) 472 amino acids
Molecular Weight 49kDa
NCBI Gene Id 3169
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Forkhead box A1
Alias Symbols HNF3A, TCF3A
Peptide Sequence Synthetic peptide located within the following region: SFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Williamson,E.A., (2006) Oncogene 25 (9), 1391-1399
Description of Target FOXA1 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.
Protein Interactions EED; SEZ6L2; AHR; ELAVL1; SUMO2; TLE1; HDAC7; HIST3H3; AR; ONECUT1; DSCAM; NRIP1; XBP1; TFF1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FOXA1 (ARP32630_P050) antibody
Blocking Peptide For anti-FOXA1 (ARP32630_P050) antibody is Catalog # AAP32630 (Previous Catalog # AAPP03639)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human FOXA1
Uniprot ID Q0JTB6
Sample Type Confirmation

FOXA1 is supported by BioGPS gene expression data to be expressed in MCF7

Protein Accession # NP_004487
Purification Affinity Purified
Nucleotide Accession # NM_004496
Tested Species Reactivity Human, Mouse
Gene Symbol FOXA1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Yeast, Zebrafish
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 86%
Image 1
MCF7
WB Suggested Anti-FOXA1 Antibody
Positive Control: Lane 1: 20ug MCF7 cell lysates Lane 2: 20ug MCF7 cell lysates Lane 3: 20ug MCF7 cell lysates Lane 4: 20ug MCF7 cell lysates Lane 5: 20ug MCF7 with FoxA1 knockdown Lane 6: 20ug MCF7 with FoxA1 knockdown
Primary Antibody Dilution : 1:1000
Secondary Antibody : Anti-rabbit-HRP
Secondry Antibody Dilution : 1:2000
Submitted by: Fu, Xiaoyong, Baylor College of MedicineFOXA1 is supported by BioGPS gene expression data to be expressed in MCF7
Image 2
Transfected 293T
WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T
Image 3
Mouse Liver
Host: Mouse
Target Name: FOXA1
Sample Tissue: Mouse Liver
Antibody Dilution: 1ug/ml
Image 4
Human heart
WB Suggested Anti-FOXA1 antibody Titration: 1 ug/mL
Sample Type: Human heart
Image 5
Human liver
WB Suggested Anti-FOXA1 antibody Titration: 1 ug/mL
Sample Type: Human liver
Image 6
heart
Rabbit Anti-FOXA1 antibody
Catalog Number: ARP32630_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
Observed Staining: Nuclei in adipocytes but not in cardiomyocytes
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Protocol located in Reviews and Data.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com