Product Number |
ARP32630_P050 |
Product Page |
www.avivasysbio.com/foxa1-antibody-c-terminal-region-arp32630-p050.html |
Name |
FOXA1 Antibody - C-terminal region (ARP32630_P050) |
Protein Size (# AA) |
472 amino acids |
Molecular Weight |
49kDa |
NCBI Gene Id |
3169 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Forkhead box A1 |
Alias Symbols |
HNF3A, TCF3A |
Peptide Sequence |
Synthetic peptide located within the following region: SFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Williamson,E.A., (2006) Oncogene 25 (9), 1391-1399 |
Description of Target |
FOXA1 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. |
Protein Interactions |
EED; SEZ6L2; AHR; ELAVL1; SUMO2; TLE1; HDAC7; HIST3H3; AR; ONECUT1; DSCAM; NRIP1; XBP1; TFF1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FOXA1 (ARP32630_P050) antibody |
Blocking Peptide |
For anti-FOXA1 (ARP32630_P050) antibody is Catalog # AAP32630 (Previous Catalog # AAPP03639) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human FOXA1 |
Uniprot ID |
Q0JTB6 |
Sample Type Confirmation |
FOXA1 is supported by BioGPS gene expression data to be expressed in MCF7 |
Protein Accession # |
NP_004487 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004496 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
FOXA1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Yeast, Zebrafish |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 86% |
Image 1 | MCF7
| WB Suggested Anti-FOXA1 Antibody Positive Control: Lane 1: 20ug MCF7 cell lysates Lane 2: 20ug MCF7 cell lysates Lane 3: 20ug MCF7 cell lysates Lane 4: 20ug MCF7 cell lysates Lane 5: 20ug MCF7 with FoxA1 knockdown Lane 6: 20ug MCF7 with FoxA1 knockdown Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-rabbit-HRP Secondry Antibody Dilution : 1:2000 Submitted by: Fu, Xiaoyong, Baylor College of MedicineFOXA1 is supported by BioGPS gene expression data to be expressed in MCF7 |
|
Image 2 | Transfected 293T
| WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/ml Positive Control: Transfected 293T |
|
Image 3 | Mouse Liver
| Host: Mouse Target Name: FOXA1 Sample Tissue: Mouse Liver Antibody Dilution: 1ug/ml |
|
Image 4 | Human heart
| WB Suggested Anti-FOXA1 antibody Titration: 1 ug/mL Sample Type: Human heart |
|
Image 5 | Human liver
| WB Suggested Anti-FOXA1 antibody Titration: 1 ug/mL Sample Type: Human liver |
|
Image 6 | heart
| Rabbit Anti-FOXA1 antibody Catalog Number: ARP32630_P050 Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Nuclei in adipocytes but not in cardiomyocytes Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 2.0 sec Protocol located in Reviews and Data. |
|