HCLS1 Antibody - N-terminal region (ARP32615_T100)

Data Sheet
 
Product Number ARP32615_T100
Product Page www.avivasysbio.com/hcls1-antibody-n-terminal-region-arp32615-t100.html
Name HCLS1 Antibody - N-terminal region (ARP32615_T100)
Protein Size (# AA) 486 amino acids
Molecular Weight 54kDa
NCBI Gene Id 3059
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Hematopoietic cell-specific Lyn substrate 1
Alias Symbols HS1, p75, CTTNL, lckBP1
Peptide Sequence Synthetic peptide located within the following region: FGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ruzzene,M., et al., (2002) Biochem. J. 364 (Pt 1), 41-47
Description of Target HS1 which is hematopoietic lineage cell-specific protein 1, is a substrate of protein tyrosine kinases in lymphocytes, it binds to F-actin, and promotes Arp2/3 complex-mediated actin polymerization. However, the mechanism for the interaction between HS1 and F-actin has not yet been fully characterized. HS1 contains 3.5 tandem repeats, a coiled-coil region, and an SH3 domain at the C terminus. Unlike cortactin, which is closely related to HS1 and requires absolutely the repeat domain for F-actin binding, an HS1 mutant with deletion of the repeat domain maintains a significant F-actin binding activity. Deletion of the coiled-coil region abolished the ability of HS1 to bind to actin filaments and to activate the Arp2/3 complex for actin nucleation and actin branching.
Protein Interactions SH2D4A; UBC; Mbp; Dlg4; NOTCH1; QKI; TERF1; TRIM29; SSBP3; BLZF1; IKBKG; LZTR1; ZBTB25; HS1BP3; HAX1; ACTR2; MAP4K1; CASP3; SYK; WAS; LYN; FGR; CSNK2A1; CD79A; ACTA1; GRB2; ACTR3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HCLS1 (ARP32615_T100) antibody
Blocking Peptide For anti-HCLS1 (ARP32615_T100) antibody is Catalog # AAP32615 (Previous Catalog # AAPP03624)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1
Uniprot ID P14317
Protein Name Hematopoietic lineage cell-specific protein
Sample Type Confirmation

HCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_005326
Purification Protein A purified
Nucleotide Accession # NM_005335
Tested Species Reactivity Human
Gene Symbol HCLS1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Jurkat
WB Suggested Anti-HCLS1 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysateHCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com