TBX21 Antibody - middle region (ARP32612_P050)

• Product Number: ARP32612_P050
• Name: TBX21 Antibody - middle region (ARP32612_P050)
• Protein Size (# AA): 535 amino acids
• Molecular Weight: 58 kDa
• NCBI Gene Id: 30009
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: T-box 21
• Alias Symbols: TBET, T-PET, T-bet, TBLYM
• Peptide Sequence: Synthetic peptide located within the following region: SIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Sasaki, Y., et al., (2004) Hum. Genet. 115 (3), 177-184
• Description of Target: TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. It is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.
• Protein Interactions: USP10; UBC; EXOC5; ZNF490; SP1; HOXC11; GATA3; EP300; CREBBP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: SPR Affinity Characterization
  
• Blocking Peptide: For anti-TBX21 (ARP32612_P050) antibody is Catalog # AAP32612 (Previous Catalog # AAPP03621)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBX21
• Uniprot ID: Q9UL17
• Protein Name: T-box transcription factor TBX21
• Protein Accession #: NP_037483
• Purification: Affinity Purified
• Nucleotide Accession #: NM_013351
• Tested Species Reactivity: Human
• Gene Symbol: TBX21
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 86%
• Image 1: Human Skeletal Muscle
  
  Human Skeletal Muscle
• Image 2: Human kidney
  
  Human kidney
• Image 3: Human Liver
  
  WB Suggested Anti-TBX21 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Liver
• Image 4: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: TBX21
  Sample Tissue: Human Jurkat Whole Cell
  Antibody Dilution: 3ug/ml
• Image 5:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.