| Product Number |
ARP32606_P050 |
| Product Page |
www.avivasysbio.com/tfcp2l1-antibody-middle-region-arp32606-p050.html |
| Name |
TFCP2L1 Antibody - middle region (ARP32606_P050) |
| Protein Size (# AA) |
479 amino acids |
| Molecular Weight |
55kDa |
| NCBI Gene Id |
29842 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transcription factor CP2-like 1 |
| Alias Symbols |
LBP9, CRTR1, LBP-9 |
| Peptide Sequence |
Synthetic peptide located within the following region: HGGEKGVPFRVQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADRKQKTD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Huang,N. (2005) Mol. Endocrinol. 19 (2), 409-420 |
| Description of Target |
TFCP2L1 is a transcriptional suppressor. TFCP2L1 may suppress UBP1-mediated transcriptional activation. It modulates the placental expression of CYP11A1. |
| Protein Interactions |
CFAP20; RBM8A; TFAP4; TFCP2L1; UBP1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TFCP2L1 (ARP32606_P050) antibody |
| Blocking Peptide |
For anti-TFCP2L1 (ARP32606_P050) antibody is Catalog # AAP32606 (Previous Catalog # AAPP03614) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TFCP2L1 |
| Uniprot ID |
Q9NZI6 |
| Protein Name |
Transcription factor CP2-like protein 1 |
| Protein Accession # |
NP_055368 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014553 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TFCP2L1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-TFCP2L1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
|
