| Product Number |
ARP32603_T100 |
| Product Page |
www.avivasysbio.com/abt1-antibody-middle-region-arp32603-t100.html |
| Name |
ABT1 Antibody - middle region (ARP32603_T100) |
| Protein Size (# AA) |
272 amino acids |
| Molecular Weight |
31kDa |
| NCBI Gene Id |
29777 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Activator of basal transcription 1 |
| Alias Symbols |
Esf2, hABT1 |
| Peptide Sequence |
Synthetic peptide located within the following region: EVAQAKRETDFYLQSVERGQRFLAADGDPARPDGSWTFAQRPTEQELRAR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Oda,T., et al., (2000) Mol. Cell. Biol. 20 (4), 1407-1418 |
| Description of Target |
Basal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by ABT1 likely activates basal transcription from class II promoters by interaction with TBP and the class II promoter DNA. |
| Protein Interactions |
FAM9B; SYNE4; LZTS2; CEP70; CCDC136; CDCA7L; EMD; UBC; PPP1CC; CAND1; PRNP; TBP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ABT1 (ARP32603_T100) antibody |
| Blocking Peptide |
For anti-ABT1 (ARP32603_T100) antibody is Catalog # AAP32603 (Previous Catalog # AAPP03611) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ABT1 |
| Uniprot ID |
Q9ULW3 |
| Protein Name |
Activator of basal transcription 1 |
| Protein Accession # |
NP_037507 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_013375 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ABT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Zebrafish: 77% |
| Image 1 | Human kidney
 | Human kidney |
|
| Image 2 | Human heart
 | WB Suggested Anti-ABT1 Antibody Titration: 1.25ug/ml
Positive Control: Human heart |
|
